PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00002.1.g00030.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 289aa    MW: 31912.2 Da    PI: 8.6043
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00002.1.g00030.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF53.82.4e-171660145
                                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
                        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                                  kri+n+  rqv +skRr+g++ KA ELS+LC+a v v++f+ +gk
  Zpz_sc00002.1.g00030.1.sm.mk 16 KRINNEDARQVCLSKRRQGLFNKACELSILCGAMVGVVVFAISGK 60
                                  79**************************************98886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.57E-22881IPR002100Transcription factor, MADS-box
SMARTSM004324.8E-26867IPR002100Transcription factor, MADS-box
PROSITE profilePS5006622.651868IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-151030IPR002100Transcription factor, MADS-box
PfamPF003191.8E-191763IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-153045IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-154566IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MVKNKTSMGR KKVKIKRINN EDARQVCLSK RRQGLFNKAC ELSILCGAMV GVVVFAISGK  60
PFSIGHPSID AVVNRFLDLN TPTAPAASNG ASQGSSGVTD VVRTLGEQYA KLQGLVEEEM  120
KRKQQLKEAT DKEMGGRFMR WLNAKIYELG QDELQEFYME LQAMKGVVFG NQELAPEAMQ  180
IPGSHAQAPM DIASASQHYK FGESISHQYQ FGESSSQHFQ FGKSSSQWYQ FGELSSQQKQ  240
SGESGSQPQA PMGMASSLEH QFGEQNTIPM PLRGTSSMMD ISQICNHKN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012699030.14e-61PREDICTED: agamous-like MADS-box protein AGL29
TrEMBLK4A0044e-61K4A004_SETIT; Uncharacterized protein
STRINGSi032189m1e-60(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2226033
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.14e-27AGAMOUS-like 61